PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vradi10g07810.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family TALE
Protein Properties Length: 238aa    MW: 27114.8 Da    PI: 5.0508
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vradi10g07810.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox29.31.5e-091631991955
                      HHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
         Homeobox  19 FeknrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                       +k +yps++++  LA+++gL+++q+ +WF N+R ++
  Vradi10g07810.1 163 HYKWPYPSESQKLALAESTGLDQKQINNWFINQRKRH 199
                      45679*****************************885 PP

2ELK41.92.1e-14119140122
              ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                      ELK qLlrKYsgyLgsLkqEF+
  Vradi10g07810.1 119 ELKGQLLRKYSGYLGSLKQEFM 140
                      9********************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012563.3E-203586IPR005541KNOX2
PfamPF037917.8E-193879IPR005541KNOX2
PROSITE profilePS5121311.174119139IPR005539ELK domain
SMARTSM011882.8E-8119140IPR005539ELK domain
PfamPF037893.5E-11119140IPR005539ELK domain
PROSITE profilePS5007113.086139202IPR001356Homeobox domain
SMARTSM003891.2E-12141206IPR001356Homeobox domain
SuperFamilySSF466896.84E-20141217IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.3E-28144204IPR009057Homeodomain-like
CDDcd000869.22E-13151203No hitNo description
PfamPF059203.5E-17159198IPR008422Homeobox KN domain
PROSITE patternPS000270177200IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 238 aa     Download sequence    Send to blast
MVFTRSLQVG APPEVVARLE EACASTVTMT GDAAGSSCIG EDPALDQFME AYCEMLTKYE  60
QELSKPLKEA MLFLQRVECE NLDIAPSVSC NEGGGDRNGS SEEDVDLQSM IDPQAEDREL  120
KGQLLRKYSG YLGSLKQEFM KKRKKGKLPK EARQQLLEWW SRHYKWPYPS ESQKLALAES  180
TGLDQKQINN WFINQRKRHW KPSEDMQFVV MDPSHPHYYV DTVMANPFPM DLSHPML*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1134143LKQEFMKKRK
2140144KKRKK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankSOYHOMEOGE0.0L13663.1 Glycine max homeobox-containing (Sbh1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014518717.11e-155PREDICTED: homeobox protein SBH1-like isoform X3
RefseqXP_014518718.11e-155PREDICTED: homeobox protein SBH1-like isoform X3
SwissprotP466081e-143HSBH1_SOYBN; Homeobox protein SBH1
TrEMBLA0A0L9VF161e-151A0A0L9VF16_PHAAN; Uncharacterized protein
TrEMBLA0A0S3S3Z41e-150A0A0S3S3Z4_PHAAN; Uncharacterized protein
STRINGGLYMA09G01000.21e-140(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20393480
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G62360.11e-113KNOX/ELK homeobox transcription factor